DPCstruct | MC26709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 111 ± 16 aa |
| Standard deviation of domain lengths | 16.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3AFX2 | 1-119 | MAGGPGPRPLPPFAVRRSRRARHARITVSPRHGVVVVVPESWRTFDPAAAVEERLDWVLAALERYAPYAAAPVAAPEALMPDRVSFA… |
| A0A373Q188 | 2-89 | VDYEIKYTNRKTLAIYITKDARVEVRCNKRVRKADIERFICEKEKWINEKLELMRNRKSVLLGNGSKILYLGKEYEIVVSESKEGMCD |
| A0A3M0C6Z4 | 4-105 | None |
| A0A1B4XFY4 | 1-138 | None |
| A0A7K0QQ98 | 224-336 | None |
| A0A5M8P6I3 | 34-157 | None |
| A0A1F5NRZ1 | 1-141 | None |
| A0A1W9L9L0 | 3-119 | None |
| A0A2N1V7S1 | 2-116 | None |
| A0A7X4F3W8 | 11-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.