DPCstruct | MC26707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 176 |
|---|---|
| Mean domain length (aa) | 184 ± 34 aa |
| Standard deviation of domain lengths | 34.29 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 13.29 |
| Pfam Score | 43.59 |
| Assigned Pfam label(s) | PF19940- CL0091- PF11692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0C4M8 | 19-180 | GKALSVHFSEMNDRREKGSLTSMDRLQCKVMYNSMICLGWLFYPEAAEVLHHYLYGKGTDLYLEPGYVRNSPVVQHALGSMKTGDVK… |
| A0A373PWS4 | 172-338 | RNIWRLGAEYYLRNRKGWYLTATLLELSTYGSGQHFEAHNGEYAADLIKYNSGFRKQVNDYLWSNGTQYDYSYAFFTFTYAFDVSGG… |
| A0A2A7I865 | 684-907 | None |
| A0A6C1C170 | 98-284 | None |
| A0A1Q6G4T3 | 330-568 | None |
| A0A517YBZ6 | 149-382 | None |
| A0A1H4M725 | 169-364 | None |
| A0A1Y0CCK8 | 109-312 | None |
| A0A7W8QKY0 | 198-413 | None |
| A0A376BXH8 | 42-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.