DPCstruct | MC2670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 64 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662PTG4 | 21-78 | LTLLQWLKLKLFGITSVGKRRYPRWRGHLPFYIYKCPNCGGMHLDYPHGYRGVLLCSQ |
| A0A1F5DW72 | 32-91 | LSIKEKIMLKLQGSLEIGKILIYGWKNRLPFYLFKCPDHGYQINYLSGHYMSLHCPKCLH |
| A0A524A1L4 | 9-66 | None |
| A0A1F6EFQ5 | 34-94 | None |
| A0A497MVH6 | 15-87 | None |
| A0A7J4NX45 | 2-75 | None |
| A0A2M7R6H7 | 13-77 | None |
| A0A662H942 | 11-85 | None |
| A0A6A8AST5 | 17-78 | None |
| A0A842QUB1 | 6-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.