DPCstruct | MC267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 138 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 92.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5YBU9 | 94-234 | QIAISGFCNGQIEINEFNKFWNQLLKRTKINLVLFQDGIGTNKLTFSNLPDYLAAFKKAAIDNQRELGVIVEIFRQTDGYPINKKTF… |
| A0A645GM28 | 1-132 | MDDKFLDQLDRLEVDFVAYLDEIGVRKANIEWTPFYFERLKQAHDKVGKAELWADMEVFQFEGPIYKTPLHPAPIERILKQLEGISP… |
| A0A4Y1VG64 | 609-756 | None |
| A0A0D6GQZ5 | 109-242 | None |
| A0A1Q2MH06 | 190-325 | None |
| A0A1V5LN75 | 41-176 | None |
| A0A1G0ZD41 | 565-704 | None |
| A0A3C1K7M0 | 105-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.