DPCstruct | MC26699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 4.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361- PF11722 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1FL27 | 30-95 | KRCDFYLSKKRRYCANSPLPDSKFCGNHNPSSKSRRVPCPIDPSHSVFRENLDAHVKKCPLKKQVE |
| A0A0N4ULH3 | 1-65 | MERCSFILPKKKRRCKMLVKKGNKFCGEHFIFDENNVERIPCPNDPKHTVNRNELEDHLNNRCNS |
| R1BN84 | 10-78 | None |
| A0A7R8X8N7 | 6-78 | None |
| A0A0D8X9Z8 | 358-432 | None |
| A0A1X7TNY1 | 8-71 | None |
| A0A673UTS4 | 14-80 | None |
| A0A0N4YBQ0 | 1-74 | None |
| A0A2H1C5R7 | 5-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.