DPCstruct | MC26696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 7.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 72.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9AU88 | 1-74 | MSQAASLIPRRSLAGAADHHGPPKVNCWQDPMNPSKWKEEHFVIVSLSGWGLLFFSGYKFFTKGKGKKEEVLLY |
| M1BNY3 | 28-95 | QGALLIQRRGLAGGGDHHGPPKVNFWQDPMSPSKWKEEHFVIVSLTGWGLAFYGAYKLFTKEKKEKKE |
| A0A072VBK6 | 27-83 | None |
| A0A2P5YRQ1 | 79-160 | None |
| A0A2K1KF07 | 109-176 | None |
| A0A5J5A031 | 200-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.