DPCstruct | MC26695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 190 ± 24 aa |
| Standard deviation of domain lengths | 24.27 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377M887 | 21-175 | LVGHLAENEVRGDLSYIDKAFGVHSARAIQEELMGRPVTLRELSDLLNLEGYPIDYSTISRMEDTIKYLWPCIPNLLNSGLARLQVL… |
| A0A4V6JLJ9 | 3-189 | YWAILAENEVRGELSFIEKSAGDPQSRSIYEEQMGKTVSLRQLSELLTHEGLPVHYSTVSRMEDALKYLYPWIPDLLESGLGRPQIT… |
| Q7VMK4 | 4-211 | None |
| D4X4D2 | 123-299 | None |
| A0A7X4B7L0 | 111-302 | None |
| A0A1B8YF02 | 128-314 | None |
| A0A482Z250 | 38-254 | None |
| A0A378ASV9 | 44-231 | None |
| A0A6A1R142 | 165-403 | None |
| A0A378N145 | 7-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.