DPCstruct | MC26689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 226 ± 15 aa |
| Standard deviation of domain lengths | 14.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07520 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2MQ41 | 171-392 | LTGRPSRFPGIQALVRHLQPLPGSRILSLEGYHTSDWYPFNKHGRIDNPKSTAAVGAMLCLLALDLRLSSFWFRAGDFEPYSTIRYL… |
| A0A4U9HZU6 | 1-207 | MLPLHGYETGGWYPFNKKGCIDDPKSTASVGAMLYLLAENSRLSSFFFRTQNFVPYSTIRYLGMLDGNNLIKDSNVFYRDIDLDAQT… |
| J6CJ48 | 139-339 | None |
| A0A2U1VWL9 | 757-993 | None |
| A0A836QTI5 | 124-345 | None |
| F4MZ40 | 512-749 | None |
| A0A7C3W7U8 | 154-392 | None |
| A0A379D0S0 | 66-292 | None |
| A0A7C7R2U2 | 216-431 | None |
| A0A3C2EFC9 | 1-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.