DPCstruct | MC26687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 157 ± 18 aa |
| Standard deviation of domain lengths | 17.81 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9HL98 | 21-180 | ADWTDDQIWALNRGGHDPKKVYAALKKAQETKGKATVILAHTVKGYGMGDTAEGKNIAHQVKKMNMDGVRYIRDRFNVPVTDEQVEN… |
| A0A447QCH5 | 349-515 | VKDMTDDEIWALNRGGHDPKKVFAALKKAQDTQGKPTVILAHTIKGYGMGETAEGKNIAHQVKKMNMEGVHHFRDRFNVPVADAGIE… |
| A0A6F8XYW0 | 206-340 | None |
| A0A6H2FPK2 | 350-535 | None |
| A0A5E6NIZ4 | 1-165 | None |
| A0A090P419 | 172-326 | None |
| X8FGN8 | 29-178 | None |
| A0A024HQC2 | 167-343 | None |
| A0A7R9AF54 | 1-138 | None |
| A0A4D4MN44 | 156-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.