DPCstruct | MC26683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 4.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S3RDK9 | 1-73 | MKKPAPLDTAAIARADKFNATIFLGTGRYRSESFGSLSEAREAADRFAKEANNGRLGMVYASTPEGRSIFVPA |
| Q3SUG4 | 3-81 | RRKVHPADAANAAVLANAVRYDVALFLGTGRYARASAPTLEDARIEAMRLVADNPTPFGKRLPLIYGVTAEGRSALVTS |
| A0A528KNQ0 | 7-85 | None |
| A0A1L3FA53 | 1-78 | None |
| A0A0R3LWK1 | 2-86 | None |
| A0A0R3KUS3 | 3-88 | None |
| A0A285V2A5 | 1-84 | None |
| A0A432V164 | 1-87 | None |
| A0A258A8L4 | 1-76 | None |
| A0A850I3S1 | 57-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.