DPCstruct | MC26681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 140 ± 25 aa |
| Standard deviation of domain lengths | 24.91 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3CWM8 | 1-102 | MSPLNPLGFDSKASLPASTFKTKALPLHINVTHTPPSIPDDESAPATSADPGFLATLSLLPTSFATGSYGWKGTKRFAVELPNPDGG… |
| K5XIK4 | 13-120 | IQYTGLAHSSSEVNPNLKETPPASIFTEKVLPLHANITHSPPNLLEDGESERVDDPGHIGTLTLVPCTFADGSLGWKGRRKVNVELL… |
| A0A4R0R901 | 26-182 | None |
| F4RDY3 | 1-141 | None |
| A0A1Y1Y154 | 12-138 | None |
| A0A1A6ADJ1 | 25-165 | None |
| A0A5N5QRL2 | 44-178 | None |
| A0A137QXK0 | 1-107 | None |
| A0A4Y7QJ26 | 1-146 | None |
| A0A4Y7TQ47 | 86-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.