DPCstruct | MC2668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Standard deviation of domain lengths | 4.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B8UAD8 | 28-86 | LSKIKKELSGRYACYVLITCSDPSGDGKMEVEMNYEGDEMLAAFLLENAGQVFDQKLSS |
| A0A7W1GVM3 | 5-64 | CHKRLQEVLDKNPSCYVLITCGEPSEDGKMNVEMTYQGDVTLASYLLQGAQTLIDHAEEQ |
| F8L338 | 9-68 | None |
| A0A1F8J352 | 7-65 | None |
| A0A0H5DPK5 | 1-61 | None |
| A0A831YBM1 | 2-61 | None |
| A0A6M1ZCQ0 | 3-54 | None |
| A0A5C7WUI5 | 1-59 | None |
| A0A2A4YDL9 | 9-57 | None |
| A0A6M2AGB0 | 16-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.