DPCstruct | MC2667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 149 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8J2K4 | 506-662 | ALPKERTVGEYLEQGPELLFLYHPALGPLYSIIQRKIQGGHFHLGASVLFELADLYAKNLEVNGCLEIYAEKPIGHYSSKGDLHFSK… |
| A0A3B8U6P2 | 13-135 | IGQKIKHGSLSLGSELQIELAQAYLEHVDVQGSLRILAQRPTESRCYLRNVRVMNQGVDWNSSRPFWAYELVRPESMQIVLQGSSEF… |
| A0A7S2AJI6 | 1-153 | None |
| C1E5I4 | 219-377 | None |
| A0A4D9C5A4 | 213-369 | None |
| A0A4D9BEG4 | 83-242 | None |
| A0A351ILZ1 | 363-494 | None |
| A0A087STG3 | 348-514 | None |
| K2FBS3 | 23-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.