DPCstruct | MC26668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 143 ± 14 aa |
| Standard deviation of domain lengths | 13.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 42.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P2SLH9 | 54-201 | TMRGNIVAAEGSKANVTLNNSHLIGWAKATSMSIDPTSQWSVTGPSTVKQLKNEGKIEFQAPSATSSHAMGTPVYKTLSLGSLSGTG… |
| A0A4P2SME5 | 1-163 | MSSTLKGDVTVGERGQLNVINNGELDTHEANLNLSGRVNLDNDPDPGKVSRFRKVSMNQGHFYFDYSISGGFSKNYSILFLETLSGT… |
| A0A248KJ54 | 1-118 | None |
| A0A376TE12 | 201-356 | None |
| A0A376SBQ8 | 1-137 | None |
| A0A485JG00 | 221-353 | None |
| C4K463 | 11-161 | None |
| A0A6D0EZP2 | 674-825 | None |
| A0A377D0G1 | 60-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.