DPCstruct | MC26665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 140 ± 22 aa |
| Standard deviation of domain lengths | 21.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 67.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 19.89 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF04347- PF00813 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0K3F6 | 19-142 | ENPLTIMLRFLVGIAVVFLLLWLLYRWVKRTNLGDYQGPGLRLISRLALTRSAMVAVVEIGGRMFLVGAGDSAVTPIAELYDTEEMA… |
| A0A2A9FT20 | 21-163 | MAEPAASQAQAQTQLSGATRTPDTLSTLVSLGLGLLAVIAIIYGCAWLIRRMTGMTGMNNSAIKVVSVMALGARERIAVVDVAGQQL… |
| A0A292RKA7 | 4-131 | None |
| A0A0X3T6V7 | 20-164 | None |
| A0A838UQ70 | 64-263 | None |
| A0LDK8 | 12-120 | None |
| A0A0E8D290 | 4-107 | None |
| D3UGX1 | 138-252 | None |
| A0A3M1UGB6 | 6-138 | None |
| A0A2N0QM87 | 6-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.