DPCstruct | MC26664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 200 ± 16 aa |
| Standard deviation of domain lengths | 16.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7GLA4 | 2-205 | AAQRRWAGVARRAVRAGAESERVFSLAQAVVARWWEQALQWERETIWPRRLHQVAGGDAGGALERWRIVGRDAVVFPEVVAVADALL… |
| A0A7K2GEX4 | 171-335 | AQRQHARLLHRSPIGAQAFEVARAVTNSWWEQPWPRQERAWPARLDATRPDGADPGWWKVAARDLISYPEAVTVARVLANPRWQQHT… |
| A0A4D4MDV6 | 9-212 | None |
| A0A6G4YD13 | 22-231 | None |
| A0A7W2URG9 | 168-378 | None |
| A0A1C5EYF8 | 5-190 | None |
| G2GNL3 | 163-358 | None |
| A0A495H3N3 | 168-359 | None |
| A0A2P8B5N6 | 168-356 | None |
| A0A4Z1CTX6 | 161-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.