DPCstruct | MC2666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 248 ± 37 aa |
| Standard deviation of domain lengths | 36.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653DYC0 | 1-198 | MNIKEHDNFMVGVQHALSLPIRARCAELTVLLDRGSLLELHSFFPVLIDNIFGPQGTLAWGLRSITEAQEDFHQLHHFLSPCGPLFK… |
| A0A6J3KKH9 | 2-281 | AASSDVATIKLQRYINMPLVQRCKEIATLIDESSTTELQHVFSILVDSLFGITDNIGWGLHSITFKKNPQEHETLYNFLNPQGPVFS… |
| A0A1B6CMT9 | 2-294 | None |
| B4DEV6 | 6-236 | None |
| A0A1Y3BSP5 | 9-229 | None |
| A0A5B7CWG7 | 3-252 | None |
| A0A087GNC7 | 418-707 | None |
| S4RG54 | 24-288 | None |
| T1KL36 | 1-208 | None |
| A0A565C3P9 | 3-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.