DPCstruct | MC26659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 8.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A6JN09 | 1-97 | MRRPLHQRREEMQFEGALVREQGVTFAIVIVKPHVLNSGHQADEVAYSFQPAFPGVPIVLMAQNSRGVPTYRGRRDLVNFLSRVPMQ… |
| A0A366HJM9 | 2-83 | YKTRIAIFQQRDRQIIVIPLDCSFEDRPLSQRCEALANIQKAALKAGLDAPAAAVWRVGNKLRFMAPTEWHPFLKTLTWNTI |
| A0A0R1SDG7 | 1-83 | None |
| F6IGK4 | 44-129 | None |
| A0A7V9REH9 | 1-92 | None |
| A0A6C1PLB0 | 1-103 | None |
| A0A2N7RSW4 | 1-82 | None |
| A0A349U8D2 | 7-75 | None |
| A0A2G3LAB6 | 23-110 | None |
| A0A143PFH6 | 94-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.