DPCstruct | MC26658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 10.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0UFQ5 | 82-203 | TPFGAVLGVADGAEGRSNCVSTCIRLEYSYLDPTSGIVSVYPDDPQQEQLQYVGVTYQCVEYARKWWMKNLGFTFGSIDSAYEILYL… |
| A0A0H3DSU9 | 6-114 | THNDAPFGTLLGYAPGGVAIYSSDYSTLDPRVYPDEASLRSYIDDEYMGHKWQCVEFARRFLFLNYGVVFTDVGMAYEIFSLRFLRQ… |
| X2JQB8 | 4-115 | None |
| A0A820NQ82 | 1-107 | None |
| A0A819R400 | 332-428 | None |
| W4GD72 | 207-323 | None |
| A0A821GAQ8 | 36-137 | None |
| A0A814RMY5 | 31-136 | None |
| A0A3R7CX57 | 141-262 | None |
| A0A819IUZ7 | 47-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.