DPCstruct | MC26657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 334 ± 40 aa |
| Standard deviation of domain lengths | 40.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.68 |
| Pfam Score | 41.67 |
| Assigned Pfam label(s) | CL0182- CL0471- PF21113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4WFG3 | 1-283 | NCKEKEDLVYLGKTHFNTPIYLNKLITKVDKIVAINSIEPHYFAGYTGGRKTFLPGIAGYETISANHFLSLNKEATLLALKNNPVSS… |
| A0A3D0ULI9 | 1-262 | MRILTGFIEPHFFAGFSGGPKAILPSLAGAESVFTNHGLQMIAHPEATWGITAGNPIWEEMREVALRTQPTFLLNVTLNVDRQITGV… |
| A0A1V4XA90 | 37-375 | None |
| A0A812VK18 | 10-376 | None |
| A0A2A5NZX8 | 15-319 | None |
| A0A7X7KN72 | 1-300 | None |
| A0A7E4SF04 | 749-1107 | None |
| A0A2S0VYC4 | 194-578 | None |
| A0A1Y4CGP2 | 71-429 | None |
| A0A7C6DQU6 | 15-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.