DPCstruct | MC26655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Standard deviation of domain lengths | 9.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 19.60 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0031- CL0397- CL0710 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3WE37 | 184-251 | KKDLTGASVKEAYAELELAIEKTESGYIVLLTDSTEIAKAIQEYVEEKGGTVFPHYGNTGTTLNILIG |
| A0A7C3UY97 | 4-74 | NKIVKVDCRGLSCPEPVIRTKKAIEAIKTGSIVVPVDRETAKENIVRLAKNFGCDVSSKEKEGIFEIRITK |
| A0A7C5MW43 | 22-100 | None |
| A0A256HLT8 | 11-90 | None |
| A0A212DLY1 | 14-93 | None |
| A0A353V6G8 | 298-373 | None |
| A0A7Y2IVP7 | 2-60 | None |
| A0A2E9Y370 | 12-84 | None |
| A0A2W6AP76 | 135-216 | None |
| A0A437JDJ4 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.