DPCstruct | MC26652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 359 ± 38 aa |
| Standard deviation of domain lengths | 38.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y6X581 | 175-516 | LNPVDRPIAQRPEFLGRKSPGLGAAETQQYYAQIQAPGTLEAFRSIYGFAAGGDVTATYYNDGDLGLGREMHCKPFAVPPSQVGLAC… |
| A0A1P8FKH0 | 31-419 | TRTSIPTPPVEPVVGPDKFLMFPNPQKQADGTVQTTTDAYAAAYYRANDPNNERDTLAKWKAKNGFETGTGQEITVVFGDQRDLGYG… |
| A0A538Q5R9 | 95-463 | None |
| A0A3D4U9L0 | 148-511 | None |
| A0A7Y6XKN0 | 514-947 | None |
| A0A7W1AGZ4 | 3-247 | None |
| A0A1F8RQS0 | 1-342 | None |
| A0A3N1JTM5 | 200-633 | None |
| V5C1G9 | 184-556 | None |
| A0A538PWN4 | 12-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.