DPCstruct | MC26651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 12.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 63.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 56.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287W7J1 | 1-111 | SLKKKIGDADVYSQAASNLVSGGILEQTVQQILDMGGGTWERDMVVRALRAAYNNPERAIDYLYSGIPESVEAPPVARAPAPAQQAQ… |
| A0A0P0VIT9 | 1-92 | MAKASTEADIYGLAASNLVAGSNLEGTVQSILEMGGGAWDRDTVMRALGAAYNNPERAVEYLYTGLPGQAEASAVVQALSVPAAVQA… |
| A0A287TR08 | 4-76 | None |
| A0A453KSR2 | 1-83 | None |
| A0A453NIC9 | 81-179 | None |
| A0A2K2ASJ3 | 45-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.