DPCstruct | MC2665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 174 ± 29 aa |
| Standard deviation of domain lengths | 28.58 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09767 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q23483 | 3-188 | FFHFINCFALAFAPYFIVYKYSGINEYSSIWKCATASGGYLLTQLAKLLIIATFFPALDSEGFSIVPEFLKSSADIIDVIGLHLLMT… |
| A0A6J3K3R3 | 2-156 | TLYHFGNCLALVYVPYYLTYKYSGLSEYGAFWKCIQAGGIYIFTQLVKMLALATFFPTADNVGGEGYDLIGEFLKSSIDLADLVGIL… |
| A0A0S4MKJ6 | 31-207 | None |
| A0A2H2JFZ8 | 1-115 | None |
| A0A090MYZ0 | 1-140 | None |
| Q7Y0D5 | 77-262 | None |
| G4V9J3 | 2-187 | None |
| A0A6A5D989 | 2-188 | None |
| A0C428 | 29-203 | None |
| A0A7G2E0H6 | 5-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.