DPCstruct | MC26649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 191 ± 19 aa |
| Standard deviation of domain lengths | 19.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835R2L2 | 3-170 | APPSSVGGSALALHYANVIIIIEKLLSYPHLVGEEARDDLYQMLPSSLKTTLRKSLKSYVKDMAIYDAPLAHGWKDALHEILSWLSP… |
| A0A0P0VAZ1 | 45-240 | EKLVDIVHFLHLEIHNAFGRSDNEESQEPTKRRNRLGPAGLALHYANIISQIDTLVSRSSSIPPNTRDALYQSLPPTVKSSLRSKVN… |
| A0A7I4F4L6 | 382-564 | None |
| A0A1B6PQG1 | 473-677 | None |
| A0A199VQX7 | 18-195 | None |
| A0A6A4PQU6 | 9-202 | None |
| A0A1R3HYV7 | 70-291 | None |
| A0A6V7NPI5 | 217-418 | None |
| A0A287XXZ7 | 35-238 | None |
| A0A1D6QKA6 | 48-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.