DPCstruct | MC26645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 321 ± 56 aa |
| Standard deviation of domain lengths | 55.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453K022 | 2-291 | ARLLIAITILFIQQLVFAVILCPLAALYLCGLVITGGISLWRLIRRDYGEVDGGANLQPALNVLYSLALFQGVLFCYRFFSYSAGDG… |
| A0A0P0V3Q5 | 108-377 | DDYTKIFLELFSAFINGRSCLAVLYQTTLGYAQLAAVIGTMVISSLRLKRQDYVDPIYQQNDDHKNIRWSLNIFYGLALSQCIVYFL… |
| A0A5J5C130 | 13-308 | None |
| A0A835ERU5 | 1-313 | None |
| A0A835AI52 | 91-419 | None |
| A0A0D9Y047 | 16-382 | None |
| A0A0E0H4T9 | 39-409 | None |
| A0A453DF71 | 36-310 | None |
| A0A368PWL9 | 8-344 | None |
| A0A0E0MND6 | 40-486 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.