DPCstruct | MC26641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Standard deviation of domain lengths | 5.74 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0F4C7 | 2-57 | RTTYMAKPGEIDRKWYVVDATDVPLGRLSTVVASILRGKNKPTFTPNVDTGDNVIV |
| A0A0N7KKE4 | 2-62 | EQKALADLRRINLDGLRWCVFDAKGQVLGRLASQIAVVLQGKDKPTYAPHVENRDMCVVLN |
| A0A6A2YSB9 | 230-298 | None |
| A0A7J7N2Z6 | 2-69 | None |
| A0A1Q7TA42 | 2-60 | None |
| A0A6A5KWP9 | 1-56 | None |
| A0A835KJ18 | 2-62 | None |
| A0A2P5WUM7 | 947-1015 | None |
| B8A0V3 | 80-141 | None |
| A0A836DCU7 | 17-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.