DPCstruct | MC26640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 4.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 65.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 59.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N7KJK3 | 1-62 | VVTIAKASPDTAERNCRICHLGLDSAVAESGSSMFLGCSCKDDLSCAHKQCAETWFKFRGNR |
| A0A2U1KMB3 | 13-74 | VNVILVVDDDIRDCRICQLSSLVDNDEQEDDELIELGCCCKDDLALAHQHCADTWFKIKGNK |
| A0A6A3D131 | 86-143 | None |
| A0A6P8DTA5 | 80-138 | None |
| A0A5D3D2W7 | 70-135 | None |
| A0A1W0W0G7 | 115-176 | None |
| A0A251NWB7 | 74-141 | None |
| A0A804JVW5 | 98-154 | None |
| A0A175YI61 | 61-120 | None |
| M1BNF3 | 63-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.