DPCstruct | MC2664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 166 ± 17 aa |
| Standard deviation of domain lengths | 17.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E8H6M0 | 6-167 | ITRGDLDGFFGLMVDNLIQLLVLSALCMGVCGFPMEFITSVVLPGAAVSLLVGNVFYAWQAWKLGQRTNRSDVTAIPYGINTVSLFA… |
| A0A7W5PAT4 | 1-186 | MAASPVGTPVHYPWYRKEDTDAFFALFQNNIANFVIIAITMLGMGFPASIVFGQVLPGAAVAVMVGNFYYAWSAARLARKENRADVT… |
| A0A817HZV9 | 61-236 | None |
| A0A4R8V8Y8 | 6-182 | None |
| A0A817SV39 | 47-200 | None |
| A0A356E7N6 | 1-147 | None |
| A0A5B8NPQ7 | 1-189 | None |
| A0A136MH52 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.