DPCstruct | MC26639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 174 ± 25 aa |
| Standard deviation of domain lengths | 24.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 30.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833XC70 | 2-144 | TFIKDVAAAQPPEHLGQLLRMLKTRGESILSPGAKQGLIPLAIPLTKNSSGAVTALLRWPTAPPGMEMPVVEVRKHGVWLLAKNVDL… |
| A0A0N7KGG0 | 4-186 | AVSRAAFASVLLAPRAVGVAARCASSSSSAASPSVAAATYDHASFIKEVAATDPPEHLSSLLNVLQARGEKLVSPGAKRGLIPLVVP… |
| A0A813HSA6 | 1-154 | None |
| A0A0G4G9Y7 | 137-291 | None |
| R1DXS3 | 346-555 | None |
| R1D7T6 | 7-133 | None |
| A0A7S1P4C3 | 29-250 | None |
| A0A2E7VPG7 | 1-189 | None |
| A0A4V6RYN2 | 3-185 | None |
| A0A812XTH7 | 50-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.