DPCstruct | MC26635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 79 ± 11 aa |
| Standard deviation of domain lengths | 11.33 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377YR97 | 1-53 | MKVLVIGNGGREHALAWKAAQSPLVDTVYVAPGNAGTALEPSLQNVAIGVTDI |
| A0A388PUH9 | 1-63 | MKVLVIGSGGREHAMAWKLSHSKKINAIFIAPGNGGTHLNPKFNNIDLTDINLLSDFAIKEKL |
| A0A7J0EQW1 | 209-298 | None |
| A0A5E4KSB3 | 1-87 | None |
| A0A839IX75 | 361-443 | None |
| A0A519TIU5 | 15-89 | None |
| A0A3B9JB06 | 1-74 | None |
| A0A0G1FKX9 | 4-66 | None |
| F4PN81 | 352-437 | None |
| A0A1V5R052 | 375-451 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.