DPCstruct | MC26633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 189 ± 17 aa |
| Standard deviation of domain lengths | 17.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20311 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3SXW3 | 109-295 | TLKAEQVKGQWTQSVWEVDDAPRYMGTASWIHSDGKNYWENVADAPLPRREYTKRNDYNVMRRGNRIRITDTGWVHEQDNDKVIRKE… |
| A0A2A4VKC2 | 29-223 | EAVSPSQQKKSWSQTVYQVDDSPRYGGVASWQHLGNYSSWNSPDTWRPLPRREYSVRKDYQLLLGENSHIILPMGWVHEQRNNKVVL… |
| A0A4Q2YHS2 | 120-304 | None |
| A0A090Q0J9 | 1-150 | None |
| A0A6I7PYU5 | 162-363 | None |
| A0A2N5Y9F9 | 198-385 | None |
| A0A2D7EYJ0 | 82-270 | None |
| A0A6I4HZE2 | 1-190 | None |
| A0A836P185 | 59-238 | None |
| A0A2E6EL11 | 201-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.