DPCstruct | MC26628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Standard deviation of domain lengths | 7.90 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846SA25 | 3-90 | HLTWGNWSLHIKDGYLEHTKGYEVELDTCRTSAKMLDWLFQIRGKSWATSEDLAELLNAFDEIIDPQTNLCSHGTSKSLSSDEMRRLI |
| A0A1F8NX12 | 43-137 | GYWWGTWKLGSRNALLCYDPNGKFDNPIYWIDLENMNSSAQILDKIFDTVSKNWVTADVLANLLWALEDIFDPQRNICAGGADLTFD… |
| A0A1Q4B535 | 9-92 | None |
| A0A2E9NIU1 | 1-93 | None |
| A0A1F7WZI1 | 12-113 | None |
| A0A1C9WUM2 | 5-93 | None |
| A0A354GL70 | 44-132 | None |
| A0A7C3BGZ7 | 27-137 | None |
| A0A848HXV9 | 26-123 | None |
| A0LL01 | 9-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.