DPCstruct | MC26627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 237 ± 36 aa |
| Standard deviation of domain lengths | 36.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8NVG5 | 1-243 | MATVYEKLRDRLDMFPQGFAKTESGVELEVLQHLFAPEEAGIMLHLKPLPEKLSAIAQRIGKDEIELGKTLYDMSKRGLLNRYKAPD… |
| A0A662E3W3 | 8-263 | KAEYRELADRLNTGSVGFPEPESETARHGWQEILEILYTPEEAALAAKLPVMPSSLRSIAARLGIGEKELKPQLDRMADKGIVMDLV… |
| A0A1F9CRD0 | 2-223 | None |
| A0A6J4XTF2 | 1-311 | None |
| R9L1N2 | 115-357 | None |
| A0A7C4ST17 | 390-633 | None |
| A0A524F7L6 | 2-220 | None |
| A0A413TZZ2 | 44-303 | None |
| A0A2N2M4S2 | 258-503 | None |
| A0A7K4H8Z7 | 2-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.