DPCstruct | MC26624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 120 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7GHD0 | 154-273 | EPADFDKQRPIDIDRPLEINPGRHQILALFIELKETLPYLFRYQTDSVVGAKGKERQAHYRVGHEDFRAAGELQVGSNETMRSLIVK… |
| A0A2W2DJV7 | 1-105 | MVKAAHFDALYPINLDYRILLGPGSQRIGAILDEATRQLPYRLRFDKSTGAQKIYQSTSLTSPGQPISIRNLAPQLIAALPEGWQLT… |
| A0A7K2HF69 | 100-211 | None |
| A0A399J341 | 110-244 | None |
| A0A1C2G2K9 | 14-133 | None |
| A0A1C4SNA9 | 191-307 | None |
| A0A3D1BB36 | 2-113 | None |
| A0A4Q3PRI9 | 58-173 | None |
| A0A5Q4SNT1 | 386-501 | None |
| A0A1Q4YEY3 | 31-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.