DPCstruct | MC26623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 135 ± 7 aa |
| Standard deviation of domain lengths | 6.88 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7M4D6 | 173-306 | PRGIWLPEGAVAQEVLEVVGDCRLQWMASGEEVLEDSLNIELTRNDQGRLLNPKFLYRPYLVSGKKRKVTMIFRDRILSDRINLVYP… |
| A0A7J3JS92 | 2-130 | GVSAKGAWTPEMAWHDRLVKIYNSSGIEYTVLCGKSHFHRTVGDKGTIYEPYEVVYDGNKLKVLFRDQEISDTIGFNNNFPSESHAI… |
| A0A259GS63 | 147-284 | None |
| A0A7Y1YSL3 | 104-232 | None |
| B8DZW9 | 256-397 | None |
| A0A535VQA0 | 255-395 | None |
| A0A7C3L4J7 | 192-323 | None |
| A0A661NV64 | 479-598 | None |
| A0A0P1NV83 | 219-359 | None |
| A0A2E6LEQ8 | 301-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.