DPCstruct | MC26621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 158 ± 22 aa |
| Standard deviation of domain lengths | 22.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.34 |
| Pfam Score | 87.64 |
| Assigned Pfam label(s) | CL0023- CL0097 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1JIQ8 | 2-150 | EKLKKIISRIDHKSYKAYKQLRGNYDFKNFTLYIDHVQGDPFASPSKFRIRVLQAKAKFTSELFSNKSRKTALEDYISRAFDTSIKN… |
| L1QJ18 | 1-153 | MKNSNDLKRELDRIDGRGYKSYKDLEGQYDFDKFILSIDHVQGDPFAAPSRIRVIVKNNINKFPIELFKEGYKRVALCDFLTRLFTK… |
| A0A1H0DG41 | 157-274 | None |
| A0A7C7R1T3 | 15-160 | None |
| D7FUV5 | 89-270 | None |
| A0A4S4LTR3 | 96-249 | None |
| A0A3P3YL31 | 488-661 | None |
| A0A812I1T9 | 25-166 | None |
| A0A140L1P3 | 1-151 | None |
| B7FSL8 | 113-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.