DPCstruct | MC2662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 305 ± 44 aa |
| Standard deviation of domain lengths | 44.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445HLQ0 | 11-318 | SAYLDALSQAIHKKLQRALANSSQRRNLLQELFADIALEVDDRAKDVIVNKEEDGISPAEDINDGPLCFYDVLADYFVRVSESRKPI… |
| A0A2P6VH78 | 38-403 | TATAAAAAVQSRLAAEVLRKLRLATQAEDKDDRDIVCAEVFADVTGELNAAAKDSTGALYRRWYEALAPHFCRSWEASEALLALCRQ… |
| A0A7S2Z0W1 | 2-211 | None |
| A0A1R3J923 | 566-917 | None |
| A0A2R6XX41 | 2-258 | None |
| A0A438G0Q1 | 282-539 | None |
| A0A5B8MWE6 | 359-657 | None |
| A0A7N0UA48 | 17-256 | None |
| A0A7S4PPX5 | 2-367 | None |
| D3BBU8 | 364-697 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.