DPCstruct | MC26611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 49 ± 3 aa |
| Standard deviation of domain lengths | 3.10 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 85.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838WFD8 | 193-241 | MRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLEKIKNDIQPWQAR |
| A0A830DFH2 | 1-54 | MRSPTGEIIFRGEIMHFWDLRARWLEPIRGPNGLDLSRLKKDIQPWQEHNQEHN |
| A0A650G361 | 342-395 | None |
| A0A4V6T3X7 | 89-130 | None |
| A0A2N9H999 | 539-587 | None |
| A0A823A6C2 | 410-458 | None |
| A0A7S0CKW5 | 251-299 | None |
| V4KQV8 | 160-211 | None |
| K0RJ67 | 283-331 | None |
| A0A7J8VRD9 | 15-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.