DPCstruct | MC2661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 113 ± 8 aa |
| Standard deviation of domain lengths | 8.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836BVY2 | 14-132 | PTPLDCESDHRACAERRLIDSWAAEARRHGQRPHQVAAWIRRKAGPRVAVWRRLQDGSLGVSVPCVCCRQLLTHLGLSVCCVTAGGG… |
| A0A2P6VFJ5 | 3-135 | SNHRCCAERRLLDTWVAAARRHGVPAHKVVPWVRRKLGPTVVVLRFRNDGSLGCSVPCVLCQRELTRFDLQVHCFLGAGASGHGGTA… |
| A0A2D4ZBH8 | 19-124 | None |
| A0A383WIR3 | 1054-1168 | None |
| A0A383WGU4 | 17-132 | None |
| A0A2V0PI12 | 37-145 | None |
| E1ZAG1 | 39-158 | None |
| A0A2E0WJQ9 | 9-113 | None |
| A0A2P6TVE7 | 40-143 | None |
| A0A2P6TU87 | 327-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.