DPCstruct | MC26609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 8.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 65.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 58.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7MVA8 | 8-86 | WGTTAKRLLLTAEQRYAFTSLSPSSTSTAPAPSPVLCGRGDKRTKKGKIFKGSYGNSRPKKEKKIQRIKDKLEVPRIVA |
| A0A830DCW3 | 1-71 | MSYFSLSSSMASPAAEAPILCSRGDKKTKKGKKFKGTYGNWRPKKEQKVERIKDKIEVPNCRPKKDKEQNI |
| A0A3S3N5S2 | 4-68 | None |
| A0A445B2Q0 | 15-78 | None |
| A0A6J1C4C8 | 6-88 | None |
| A0A835RIG5 | 24-95 | None |
| A0A6G1EI03 | 34-115 | None |
| A0A7J6FXE2 | 7-92 | None |
| A0A822ZAG0 | 1-77 | None |
| A0A2H5PKG4 | 5-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.