DPCstruct | MC2660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 132 ± 22 aa |
| Standard deviation of domain lengths | 22.07 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.28 |
| Pfam Score | 87.54 |
| Assigned Pfam label(s) | CL0765- PF10448 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R1FAN9 | 3-106 | AQVQQIGPDVMINITGGDHPHIGTVTTFGVTTALATVRFPSHDGRVHKDDVLATMVAQQIKPQITGSCTITAGVHVDQISQEQINAA… |
| A0A2P6VDX2 | 385-499 | DDSSSAMQHHTASDSYQDTPVYFQIVVLERQIFAWVGVAPPRLANLQLAMPTRLDPLPSATSLLGSADDELASMSQRLSKRTGRSVA… |
| A0A0C2JW32 | 9-127 | None |
| A0A194W6V2 | 2-133 | None |
| Q5BF16 | 1-144 | None |
| A0A094HHU7 | 14-152 | None |
| A0A0C9LMW9 | 62-208 | None |
| A0A287X4N1 | 73-198 | None |
| M9LXG4 | 7-171 | None |
| M7X1P2 | 6-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.