DPCstruct | MC266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 10.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645GJJ2 | 1-101 | MLNKKVNYQGKESTWGYVIFLKVRELAHYLTSKKEKLDFVKPEYEIERIDSYNIRQKILNISYVDWKKLGLSKGTLHYMKQNAMSDK… |
| A0A0E3WT61 | 68-184 | LKPTGARKIVNEFSNMLNKKVSYQGKESTWSYVIFLKVRELAHYLTSKKEKLDFVKPEYEIERIDSYAIRQKILNISYVDWKKLGFS… |
| A0A0E3WTE0 | 41-157 | None |
| A0A7Z8P346 | 170-287 | None |
| A0A2R6BK62 | 109-222 | None |
| A0A314ZZ12 | 3-84 | None |
| A0A0F8KIR6 | 8-108 | None |
| A0A0Q1AMQ8 | 17-117 | None |
| A0A7U3D1J4 | 21-134 | None |
| A0A0E3NPQ4 | 69-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.