DPCstruct | MC26598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 319 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 20.35 |
| Pfam Score | 92.66 |
| Assigned Pfam label(s) | CL0077- CL0437- CL0329- PF21018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6RPA7 | 5-96 | SMLLESFYAFHLTISDKMVGRAMTDLERRFAVFEGPVLEDGQAILTGRAPVSSLDGYQTEVTVYTSGLGQLVCTLDGYGPCHNEEEV… |
| A0A6C0PZ14 | 22-113 | RAGTVVCEPMNHFRLDVPADTFGAVLPALARLRAVLHTPSARGASYVVEGEIPAAEVHALEQLLPTLTSGEGVLEAAFDHHRPVRGT… |
| A0A7R9KJ60 | 649-734 | None |
| A0A1R3KGV7 | 462-548 | None |
| A0A7S0LZK5 | 3-86 | None |
| R5VIX1 | 6-94 | None |
| A0A2R6KT10 | 1-68 | None |
| A0A2K5N9N7 | 338-426 | None |
| A0A7S4NVT0 | 223-305 | None |
| A0A1I8IMR4 | 150-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.