DPCstruct | MC26590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 172 ± 19 aa |
| Standard deviation of domain lengths | 18.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 20.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0191 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U9XM10 | 9-191 | GVPKVAAGDTVEAGSVLVEGKVPIYNEDATVKEYLYVDADADIVLEHTMEFTDELPFDYVRKEYTGREKSRYYVRFGDREWKMPQER… |
| A0A061N4Y9 | 166-343 | GRAVVKSNDVVQKGELLVSGLIGREGEETAIAAKGEVMAETWYQGTVEAPLQLTGIASTGETKNQYTFTWNDYSFVFWNKDAEAEYE… |
| R5G2R2 | 129-301 | None |
| W4VDA1 | 10-172 | None |
| A0A395YSX2 | 119-310 | None |
| A0A0D0QLI6 | 86-240 | None |
| A0A3E2T6J2 | 208-386 | None |
| A0A2W4MYD1 | 38-237 | None |
| A5ZVV5 | 10-144 | None |
| E5VHV8 | 109-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.