DPCstruct | MC2659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 105 ± 22 aa |
| Standard deviation of domain lengths | 21.78 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.75 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0010- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6VBT5 | 17-128 | ARLAARHAGRRAAAAAAGNGAQAQLAEGAKVKVTAPITVFHSPKYKTGLDLQNREGVVVQPDVNDYRHHDGKQHTLSANLPIKVQFE… |
| Q8YU85 | 1-73 | MKVGDRVCVKESVVVYHHPEHRGKAFDLKGSEGEIVEIVTQWQGRPVSANLPFLIQFSKKFKAHLRENELEVI |
| A0A7S1N515 | 432-531 | None |
| A0A5B6V2B9 | 902-1007 | None |
| A0A7S0YSB1 | 23-105 | None |
| A0A835GUV9 | 46-169 | None |
| K8F3A8 | 8-92 | None |
| A0A7S0M1Q1 | 1-157 | None |
| A0A098TLM8 | 4-80 | None |
| A0A7S4J0H8 | 61-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.