DPCstruct | MC26589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 3.65 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F9ZZA5 | 27-84 | KHEAKLCPRCQREFICKANRIHCCDCSSICLSFETSEYIRQRYEECLCTACLQELAVL |
| A0A1I2AB81 | 3-64 | QHEIKVCPRCQAEFECKLGSIHLCQCTAVRLDESDRTYIREKYEDCLCLACMIALKNERKQK |
| A0A2M9YK64 | 7-63 | None |
| A0A5C6HL61 | 2-63 | None |
| A0A2P2DQ93 | 23-86 | None |
| A0A4Q5UIG8 | 1-57 | None |
| H2CKQ5 | 1-68 | None |
| A0A323TSX1 | 30-89 | None |
| R4V9U2 | 1-60 | None |
| A0A543V4Y1 | 8-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.