DPCstruct | MC26585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 62 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.84 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R7KL50 | 1-52 | MRCGAKTRKGSPCKALSLPGKRRCKFHGGLSTGPKTAEGIERIREAQRRRWA |
| A0A2N4YJU4 | 17-70 | NDRPICGARTRQGHQCKNKIVPGRTKCKFHGGLSTGPKTADGKARIAAAQKARK |
| A0A4P7HPC9 | 15-74 | None |
| A0A0W0SMC4 | 21-84 | None |
| B2UB19 | 1-47 | None |
| A0A2Z6IMH8 | 2-68 | None |
| A0A2E3K5T6 | 24-71 | None |
| A0A3S0FMW9 | 97-164 | None |
| A0A2A5W7M4 | 4-96 | None |
| A0A6C2CNJ4 | 3-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.