DPCstruct | MC26583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 150 ± 21 aa |
| Standard deviation of domain lengths | 21.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16761 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A109FKI9 | 115-279 | PHYTVVRSSNNSKQSPHRIIINPGVSDAHPDRWPPEEEYSPSRRVDGKENWYERTPKDVGRHKAFRDKVGEELAKTLKLSQRPNEFW… |
| A0A067NBC3 | 32-203 | QRAQQGGRIGSSMRIAFPPNYTDGDSSLLYDDGEKVIDENGNVNYLVSIPLTSDAGKLWRRKVGTFLAHRVLDIDRSRRSVWFVDKF… |
| R1EFD2 | 6-168 | None |
| A0A3N4KEM8 | 4-176 | None |
| A0A397SD46 | 4-183 | None |
| A0A166ANQ2 | 85-259 | None |
| A0A146HCS2 | 625-783 | None |
| A0A3N4J8T6 | 63-226 | None |
| A0A4V2MVC5 | 29-192 | None |
| A0A094HV86 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.