DPCstruct | MC26582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 255 ± 49 aa |
| Standard deviation of domain lengths | 49.36 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 19.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4HLW6 | 6-205 | KIQSLCLEIFDLHTHNDDLSTEISKLRETALEREHLKLLKHIKQLEHDTRTCKDAQSKNIYSLNCLLSESKSAFTSLQSENSTLFYS… |
| A0A067N6Y1 | 20-272 | LEKARAAKHKCSVTTPSPPSPPAPSPPPPPPPPPLPPSESASNYKCVVHNLQQKFGHAKVTGIKYQCKAAQAVKESAHVLKREAQTV… |
| A0A165BSA2 | 32-231 | None |
| A0A0C9WNJ6 | 27-315 | None |
| A0A4Q9PTH4 | 7-201 | None |
| A0A284S544 | 32-299 | None |
| A0A8B6BGE5 | 197-475 | None |
| A0A0C9VXM9 | 25-207 | None |
| A0A6A4GDH7 | 1-235 | None |
| A0A369JES6 | 29-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.